PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00116777001
Common NameGSBRNA2T00116777001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 385aa    MW: 43287 Da    PI: 9.594
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00116777001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like97.97.1e-3180133255
              G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          prlrWtpeLH rF++ave+ GG+++AtPk +l+lm+vkgL ++hvkSHLQ+YR+
  GSBRNA2T00116777001  80 PRLRWTPELHLRFLQAVEKFGGPDRATPKLVLQLMNVKGLCIAHVKSHLQMYRS 133
                          8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.22376136IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.0E-2976134IPR009057Homeodomain-like
SuperFamilySSF466891.18E-1577135IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-2380135IPR006447Myb domain, plants
PfamPF002492.8E-1081132IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 385 aa     Download sequence    Send to blast
MRSSSQSSEN SKTCPSNNFK ETTKKEDNKD DENKDEEARS VDQIPSNNSY VEESGSHHHN  60
NDQIKKNGGS VRPYNRSKTP RLRWTPELHL RFLQAVEKFG GPDRATPKLV LQLMNVKGLC  120
IAHVKSHLQM YRSKKTDDPN QGNQGFSFEH GAGYTYNLGQ LPMLQSFDQR PSTSLGYDGG  180
SWTDRRRQVY RSPWRGLTAR NSTRTRPTLF SSQSGERFRG VSNSILDDKN KAISFRINSH  240
EAAQASNGVG ESVPSIHRSF LEGPQDHIAT TLSSNQRENP RVAEETENVL KRKRLLLSDD  300
CNKSVQDLDL SLSLKVHRTH NNLGDCLLED EEKKLDDHED IKGLSLSLAS SSSSKLGRDI  360
RKEVQNDTKK RKISVLASPL DLTL*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00116777001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0070206e-88AC007020.5 Arabidopsis thaliana chromosome 2 clone T3G21 map g4514, complete sequence.
GenBankAF0852796e-88AF085279.1 Arabidopsis thaliana ABA-regulated gene cluster, complete sequence.
GenBankCP0026856e-88CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009143232.10.0PREDICTED: uncharacterized protein LOC103866965 isoform X3
TrEMBLA0A078CIE20.0A0A078CIE2_BRANA; BnaA05g05490D protein
STRINGBra004973.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM93592136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40260.11e-180G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]